Skip to Content

ELISA Recombinant Potassium voltage-gated channel subfamily KQT member 1(KCNQ1)

https://www.paratuberculosis.info/web/image/product.template/149681/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q9TTJ7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:IIDLIVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRmLHVDRQGGTWRLLGSVVFIHR QELITTLYIGFLGLIFSSYFVYLAEKDAVNESGQVEFGSYADALWWGVVTVTTIGYGDKV PQT Protein Names:Recommended name: Potassium voltage-gated channel subfamily KQT member 1 Alternative name(s): IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1 KQT-like 1 Voltage-gated potassium channel subunit Kv7.1 Gene Names:Name:KCNQ1 Synonyms:KVLQT1 Expression Region:1-123 Sequence Info:fµLl length protein

1,465.00 € 1465.0 EUR 1,465.00 €

1,465.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF871323PI