ELISA Recombinant NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial(NDUFB11)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9NX14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ESSFSRTVVAPSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL VFFFGVSIILVLGSTFVAYLPDYRMKEWSRREAERLVKYREANGLPIMESNCFDPSKIQL PEDE Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial Alternative name(s): Complex I-ESSS Short name= CI-ESSS NADH-ubiquinone oxidoreductase ESSS subunit Neuronal protein 17.3 Short name= Gene Names:Name:NDUFB11 ORF Names:UNQ111/PRO1064 Expression Region:30-153 Sequence Info:fµLl length protein