ELISA Recombinant Potassium voltage-gated channel subfamily H member 2(KCNH2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q9TUI4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LLKETEEGSQAPDCGYACQPLAVVDLIVDIMFIVDILINFRTTYVNANEEVVSHPGRIAV HYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTAR Protein Names:Recommended name: Potassium voltage-gated channel subfamily H member 2 Alternative name(s): Ether-a-go-go-related gene potassium channel 1 Short name= ERG-1 Short name= Eag-related protein 1 Short name= Ether-a-go-go-related p Gene Names:Name:KCNH2 Synonyms:ERG Expression Region:1-97 Sequence Info:fµLl length protein