Skip to Content

ELISA Recombinant Metalloreductase STEAP1(STEAP1)

https://www.paratuberculosis.info/web/image/product.template/149649/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q9GL50 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESRQDITNQEELWKMKPRKNLEDDYLNEDSRENSMPKRPmLVHLHQTAHFDEFDCPPEL QHKQELFPKWHLPIKIAAIVSSLTFLYTLLREVIHPFVTSHQQYFYKIPILVINKVLPMV SITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDRWMVTRKQFGLLSFFFAVLHAVYSLS YPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVTLAILALLAVTSIPSV SDSLTWREFHYIQSTLGIVSLLLGTIHALIFAWNKWVDIKQFIWYTPPTFMIAVFLPTVV LICKVILLLPCLRRKILKIRHGWEDVTKINKTEMSSQL Protein Names:Recommended name: Metalloreductase STEAP1 EC= 1.16.1.- Alternative name(s): Six transmembrane endothelial antigen of PAEC Six-transmembrane epithelial antigen of prostate 1 Gene Names:Name:STEAP1 Synonyms:STEAP Expression Region:1-338 Sequence Info:fµLl length protein

1,692.00 € 1692.0 EUR 1,692.00 €

1,692.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF863902PI