ELISA Recombinant Olfactory receptor 2D2(OR2D2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9H210 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGNLLLISLVHVDSQLHTPMY FFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVMSY DRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFILRLPYRGSNSIAHFFCE APALLILASTDTHASEMAIFLMGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAFST CGSHLMVVILFYGSAIITYMTPKSSKQQEKSVSVFYAIVTPmLNPLIYSLRNKDVKAALR KVATRNFP Protein Names:Recommended name: Olfactory receptor 2D2 Alternative name(s): HB2 Olfactory receptor 11-610 Short name= OR11-610 Olfactory receptor 2D1 Olfactory receptor OR11-88 Gene Names:Name:OR2D2 Synonyms:OR2D1 Expression Region:1-308 Sequence Info:fµLl length protein