ELISA Recombinant Leucine-rich repeat-containing protein 3(LRRC3)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BY71 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:CPQPCRCPDHAGAVAVFCSLRGLQEVPEDIPANTVLLKLDANKISHLPDGAFQHLHRLRE LDLSHNAIEAIGSATFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECA LQEALWELKLDPDSVDEIACHTSVQEEFVGKPLVQALDAGASLCSVPHRTTDVAmLVTMF GWFAMVIAYVVYYVRHNQEDARRHLEYLKSLPSAPASKDPIGPGP Protein Names:Recommended name: Leucine-rich repeat-containing protein 3 Gene Names:Name:LRRC3 Synonyms:C21orf102, LRRC3A ORF Names:UNQ9233/PRO31982 Expression Region:33-257 Sequence Info:fµLl length protein