ELISA Recombinant P2Y purinoceptor 13(P2RY13)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q9BPV8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTAAIRRQRELSILPKVTLEAMNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGIL LNTLALWVFVHIPSSSTFIIYLKNTLVADLIMTLmLPFKILSDSHLAPWQLRAFVCRFSS VIFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFLFFISLPNTI LSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVFILmLVFYVVIAKKVYDSYR KSKSKDRKNNKKLEGKVFVVVAVFFVCFAPFHFARVPYTHSQTNNKTDCRLQNQLFIAKE TTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG Protein Names:Recommended name: P2Y purinoceptor 13 Short name= P2Y13 Alternative name(s): G-protein coupled receptor 86 G-protein coupled receptor 94 Gene Names:Name:P2RY13 Synonyms:GPR86, GPR94 ORF Names:FKSG77 Expression Region:1-354 Sequence Info:fµLl length protein