ELISA Recombinant Membrane-spanning 4-domains subfamily A member 10(MS4A10)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96PG2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKAEATVIPSRCARGLPSWQVLSPVQPWQTSAPQNTTQPKLLAPHQHEKSQKKSSLLKEL GAFHITIALLHLVFGGYLASIVKNLHLVVLKSWYPFWGAASFLISGILAITMKTFSKTYL KmLCLMTNLISLFCVLSGLFVISKDLFLESPFESPIWRMYPNSTVHIQRLELALLCFTVL ELFLPVPTAVTAWRGDCPSAKNDDACLVPNTPLHLKGLPVEPPPSYQSVIQGDAQHKQHQ RLREVKQVAPDTWIVTDGAAIWTQTAN Protein Names:Recommended name: Membrane-spanning 4-domains subfamily A member 10 Alternative name(s): CD20 antigen-like 7 Gene Names:Name:MS4A10 Synonyms:CD20L7, MS4A9 Expression Region:1-267 Sequence Info:fµLl length protein