ELISA Recombinant Olfactory receptor 56A4(OR56A4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NGH8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASPSNDSTAPVSEFLLICFPNFQSWQHWLSLPLSLLFLLAMGANTTLLITIQLEASLHQ PLYYLLSLLSLLDIVLCLTVIPKVLAIFWFDLRSISFPACFLQMFIMNSFLTMESCTFMV MAYDRYVAICHPLRYPSIITDQFVARAVVFVIARNAFVSLPVPmLSARLRYCAGNIIKNC ICSNLSVSKLSCDDITFNQLYQFVAGWTLLGSDLILIVISYSFILKVVLRIKAEGAVAKA LSTCGSHFILILFFSTVLLVLVITNLARKRIPPDVPILLNILHHLIPPALNPIVYGVRTK EIKQGIQNLLKRL Protein Names:Recommended name: Olfactory receptor 56A4 Alternative name(s): Olfactory receptor OR11-49 Gene Names:Name:OR56A4 Expression Region:1-313 Sequence Info:fµLl length protein