ELISA Recombinant Olfactory receptor 4F4(OR4F4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96R69 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVTEFIFLGLSDSQELQTFLFmLFFVFYGGIVFGNLLIVITVVSDSHLHSPMYFLLANLS LIDLSLSSVTAPKMITDFFSQRKVISFKGCLVQIFLLHFFGGSEMVILIAMGFDRYIAIC KPLHYTTIMCGNACVGIMAVAWGIGFLHSVSQLAFAVHLPFCGPNEVDSFYCDLPRVIKL ACTDTYRLDIMVIANSGVLTVCSFVLLIISYTIILMTIQHCPLDKSSKALSTLTAHITVV LLFFGPCVFIYAWPFPIKSLDKFLAVFYSVITPLLNPIIYTLRNKDMKTAIRRLRKWDAH SSVKF Protein Names:Recommended name: Olfactory receptor 4F4 Alternative name(s): HS14a-1-A Olfactory receptor OR19-3 Gene Names:Name:OR4F4 Expression Region:1-305 Sequence Info:fµLl length protein