Skip to Content

ELISA Recombinant Lysophospholipid acyltransferase 7(MBOAT7)

https://www.paratuberculosis.info/web/image/product.template/134920/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96N66 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSPEEWTYLVVLLISIPIGFLFKKAGPGLKRWGAAAVGLGLTLFTCGPHTLHSLVTILGT WALIQAQPCSCHALALAWTFSYLLFFRALSLLGLPTPTPFTNAVQLLLTLKLVSLASEVQ DLHLAQRKEMASGFSKGPTLGLLPDVPSLMETLSYSYCYVGIMTGPFFRYRTYLDWLEQP FPGAVPSLRPLLRRAWPAPLFGLLFLLSSHLFPLEAVREDAFYARPLPARLFYMIPVFFA FRMRFYVAWIAAECGCIAAGFGAYPVAAKARAGGGPTLQCPPPSSPEKAASLEYDYETIR NIDCYSTDFCVRVRDGMRYWNMTVQWWLAQYIYKSAPARSYVLRSAWTmLLSAYWHGLHP GYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHWFLKMRAYDYMCMGFVLLSLA DTLRYWASIYFCIHFLALAALGLGLALGGGSPSRRKAASQPTSLAPEKLREE Protein Names:Recommended name: Lysophospholipid acyltransferase 7 Short name= LPLAT 7 EC= 2.3.1.- Alternative name(s): 1-acylglycerophosphatidylinositol O-acyltransferase EC= 2.3.1.n4 Bladder and breast carcinoma-overexpressed gene 1 p Gene Names:Name:MBOAT7 Synonyms:BB1, LENG4, OACT7 Expression Region:1-472 Sequence Info:fµLl length protein

1,833.00 € 1833.0 EUR 1,833.00 €

1,833.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF850398HU