ELISA Recombinant Olfactory receptor 52K2(OR52K2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NGK3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSASNITLTHPTAFLLVGIPGLEHLHIWISIPFCLAYTLALLGNCTLLLIIQADAALHEP MYLFLAmLAAIDLVLSSSALPKmLAIFWFRDREINFFACLAQMFFLHSFSIMESAVLLAM AFDRYVAICKPLHYTKVLTGSLITKIGMAAVARAVTLMTPLPFLLRCFHYCRGPVIAHCY CEHMAVVRLACGDTSFNNIYGIAVAMFIVVLDLLLVILSYIFILQAVLLLASQEARYKAF GTCVSHIGAILAFYTTVVISSVMHRVARHAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ IRESILGVFPRKDM Protein Names:Recommended name: Olfactory receptor 52K2 Alternative name(s): Olfactory receptor OR11-7 Gene Names:Name:OR52K2 Expression Region:1-314 Sequence Info:fµLl length protein