Skip to Content

ELISA Recombinant Palmitoyltransferase ZDHHC15(ZDHHC15)

https://www.paratuberculosis.info/web/image/product.template/136702/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96MV8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLIL YHAIFVFFTWTYWKSIFTLPQQPNQKFHLSYTDKERYENEERPEVQKQmLVDMAKKLPVY TRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAY SVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSR NKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDKKKFWLIPIGSSPGDGHSFPMRSM NESQNPLLANEETWEDNEDDNQDYPEGSSSLAVETET Protein Names:Recommended name: Palmitoyltransferase ZDHHC15 EC= 2.3.1.- Alternative name(s): Zinc finger DHHC domain-containing protein 15 Short name= DHHC-15 Gene Names:Name:ZDHHC15 ORF Names:UNQ1969/PRO4501 Expression Region:1-337 Sequence Info:fµLl length protein

1,691.00 € 1691.0 EUR 1,691.00 €

1,691.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF842720HU