Skip to Content

ELISA Recombinant Olfactory receptor 4A16(OR4A16)

https://www.paratuberculosis.info/web/image/product.template/136323/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NH70 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRPSSNVTEFVLLGLTQDPDVKKTLFVMFLLIYIVTMVGNLLIWVTTIGSPSLGSLMYFF LAYLSLMDAIYSTAMSPKLMIDLLCDKIAISLSACMGQLFIEHLLGGAEVFLLVVMAYDR YVAISKPLHYLNIMNRLVCILLLVVAMIGGFVHSVVQIVFLYSLPICGPNVIDHSVCDMY PLLELLCLDTYFIGLTVVANGGIICMVIFTFLLISCGVILNFLKTYSQEERHKALPTCIS HIIVVALVFVPCIFMYVRPVSNFPFDKLMTVFYSIITLmLNPLIYSLRQSEMKNAMKNLW CEKLSIVRKRVSPTLNIFIPSSKATNRR Protein Names:Recommended name: Olfactory receptor 4A16 Alternative name(s): Olfactory receptor OR11-117 Gene Names:Name:OR4A16 Expression Region:1-328 Sequence Info:fµLl length protein

1,681.00 € 1681.0 EUR 1,681.00 €

1,681.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF839911HU