Skip to Content

ELISA Recombinant Olfactory receptor 2AJ1(OR2AJ1)

https://www.paratuberculosis.info/web/image/product.template/136265/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NGZ0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGHQNHTFSSDFILLGLFSSSPTSVVFFLVLFVIFIMSVTENTLMILLIRSDSRLHTPMY FLLSHLSLMDILHVSNIVPKMVTNFLSGSRTISFAGCGFQVFLSLTLLGGECLLLAAMSC DRYVAICHPLRYPILMKEYASALMAGGSWLIGVFNSTVHTAYALQFPFCGSRAIDHFFCE VPAmLKLSCADTTRYERGVCVSAVIFLLIPFSLISASYGQIILTVLQMKSSEARKKSFST CSFHMIVVTMYYGPFIFTYMRPKSYHTPGQDKFLAIFYTILTPTLNPFIYSFRNKDVLAV MKNmLKSNFLHKKMNRKIPECVFCLFLC Protein Names:Recommended name: Olfactory receptor 2AJ1 Gene Names:Name:OR2AJ1 Synonyms:OR2AJ1P Expression Region:1-328 Sequence Info:fµLl length protein

1,681.00 € 1681.0 EUR 1,681.00 €

1,681.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF839905HU