ELISA Recombinant Potassium channel subfamily K member 17(KCNK17)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96T54 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MYRPRARAAPEGRVRGCAVPSTVLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELVGSFFFSVSTITTIGYG NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHWASRLGGTWQDPDKARWLA GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW YKNMVSLWILFGMAWLALIIKLILSQLETPGRVCSCCHHSSKEDFKSQSWRQGPDREPES HSPQQGCYPEGPMGIIQHLEPSAHAAGCGKDS Protein Names:Recommended name: Potassium channel subfamily K member 17 Alternative name(s): 2P domain potassium channel Talk-2 Acid-sensitive potassium channel protein TASK-4 TWIK-related acid-sensitive K(+) channel 4 TWIK-related alkaline pH-activ Gene Names:Name:KCNK17 Synonyms:TALK2, TASK4 ORF Names:UNQ5816/PRO19634 Expression Region:1-332 Sequence Info:fµLl length protein