ELISA Recombinant Olfactory receptor 10J5(OR10J5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8NHC4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKRKNFTEVSEFIFLGFSSFGKHQITLFVVFLTVYILTLVANIIIVTIICIDHHLHTPMY FFLSmLASSETVYTLVIVPRmLLSLIFHNQPISLAGCATQMFFFVILATNNCFLLTAMGY DRYVAICRPLRYTVIMSKGLCAQLVCGSFGIGLTMAVLHVTAMFNLPFCGTVVDHFFCDI YPVMKLSCIDTTINEIINYGVSSFVIFVPIGLIFISYVLVISSILQIASAEGRKKTFATC VSHLTVVIVHCGCASIAYLKPKSESSIEKDLVLSVTYTIITPLLNPVVYSLRNKEVKDAL CRVVGRNIS Protein Names:Recommended name: Olfactory receptor 10J5 Alternative name(s): Olfactory receptor OR1-28 Gene Names:Name:OR10J5 Expression Region:1-309 Sequence Info:fµLl length protein