ELISA Recombinant Mas-related G-protein coupled receptor member F(MRGPRF)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q96AM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGNCSWEAHPGNRNKMCPGLSEAPELYSRGFLTIEQIAmLPPPAVMNYIFLLLCLCGLV GNGLVLWFFGFSIKRNPFSIYFLHLASADVGYLFSKAVFSILNTGGFLGTFADYIRSVCR VLGLCMFLTGVSLLPAVSAERCASVIFPAWYWRRRPKRLSAVVCALLWVLSLLVTCLHNY FCVFLGRGAPGAACRHMDIFLGILLFLLCCPLMVLPCLALILHVECRARRRQRSAKLNHV ILAMVSVFLVSSIYLGIDWFLFWVFQIPAPFPEYVTDLCICINSSAKPIVYFLAGRDKSQ RLWEPLRVVFQRALRDGAELGEAGGSTPNTVTMEMQCPPGNAS Protein Names:Recommended name: Mas-related G-protein coupled receptor member F Short name= Mas-related gene F protein Alternative name(s): G-protein coupled receptor 140 G-protein coupled receptor 168 Gene Names:Name:MRGPRF Synonyms:GPR140, GPR168, MRGF ORF Names:PSEC0142 Expression Region:1-343 Sequence Info:fµLl length protein