ELISA Recombinant Olfactory receptor 8D1(OR8D1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q8WZ84 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMY YFLSSLSFVDFCYSSVITPKmLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAY DRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCD VLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGT CSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPmLNPLIYSLRNKDVKKA LRKVLVGK Protein Names:Recommended name: Olfactory receptor 8D1 Alternative name(s): OST004 Olfactory receptor 8D3 Olfactory receptor OR11-301 Olfactory receptor-like protein JCG9 Gene Names:Name:OR8D1 Synonyms:OR8D3 Expression Region:1-308 Sequence Info:fµLl length protein