ELISA Recombinant Membrane progestin receptor alpha(PAQR7)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:Q865K8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATMVAQKLSHLLPSLRQVHPEPQPSVHPEPVFTVDRAEVPPLFWKPYIYVGYRPLHQTW RFYFRTLFQQHNEAVNVWTHLLAALVLLLRLAIFVGTVDFWGDPHALPLFIIVLASFTYL SLSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQTIFLPMA AFLAWLSCTGSCYNKYIQKPGLLGRTCQEVPSALAYALDISPVAHRILASPEPATDDPAL LYHKCQVVFFLLAAAFFSAFMPERWFPGSCHIFGQGHQLFHVFLVLCTLAQLEAVALDYE ARRPIYEPLHTRWPHNFSGLFLLTVGSSILTAFLLSQLVRRKLDLDRKTQ Protein Names:Recommended name: Membrane progestin receptor alpha Short name= mPR alpha Alternative name(s): Progestin and adipoQ receptor family member VII Gene Names:Name:PAQR7 Synonyms:MRPA Expression Region:1-350 Sequence Info:fµLl length protein