ELISA Recombinant Gap junction beta-7 protein(GJB7)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q6PEY0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGC KNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGL WYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFI LFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV Protein Names:Recommended name: Gap junction beta-7 protein Alternative name(s): Connexin-25 Short name= Cx25 Gene Names:Name:GJB7 Synonyms:CX25 Expression Region:1-223 Sequence Info:fµLl length protein