Skip to Content

ELISA Recombinant Leucine-rich repeat-containing protein 55(LRRC55)

https://www.paratuberculosis.info/web/image/product.template/134736/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q6ZSA7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVL DLHNNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVH PQAFQGLMQLRDLDLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNR IQRCTADSQLAECRGPPEVEGAPLFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVA TNFLLGITANCCHRWSKASEEEEI Protein Names:Recommended name: Leucine-rich repeat-containing protein 55 Gene Names:Name:LRRC55 Expression Region:48-311 Sequence Info:fµLl length protein

1,614.00 € 1614.0 EUR 1,614.00 €

1,614.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF751178HU