Skip to Content

ELISA Recombinant Metalloreductase STEAP4(STEAP4)

https://www.paratuberculosis.info/web/image/product.template/135233/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q687X5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKmLQCGYSVVFGSRNPQKTTLLPS GAEVLSYSEAAKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEY LAHLVPGAHVVKAFNTISAWALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQ GSLMAAKEIEKYPLQLFPMWRFPFYLSAVLCVFLFFYCVIRDVIYPYVYEKKDNTFRMAI SIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFPDWLDHWmLCRKQLGLVALGF AFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVALGILGFFLFV LLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAY VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH Protein Names:Recommended name: Metalloreductase STEAP4 EC= 1.16.1.- Alternative name(s): Six-transmembrane epithelial antigen of prostate 4 SixTransMembrane protein of prostate 2 Tumor necrosis factor, alpha-induced protein 9 Gene Names:Name:STEAP4 Synonyms:STAMP2, TNFAIP9 Expression Region:1-459 Sequence Info:fµLl length protein

1,819.00 € 1819.0 EUR 1,819.00 €

1,819.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF731557HU