ELISA Recombinant Insulin-induced gene 1 protein(INSIG1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:Q5ZMT9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPRLESGAWSCSCAARARHAARPGEAAPKADAMQSPSPSAGRAEREASGGSATTWRQHLV QRSVVLFVVGAFMALVLNLLQIQRNVTLFPDEVIATLFSSAWWVPPCCGTAAAVVGLLYP CIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFD RSRSGLGLGITIAFVATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQ LAMGIPEKPHND Protein Names:Recommended name: InsµLin-induced gene 1 protein Short name= INSIG-1 Gene Names:Name:INSIG1 ORF Names:RCJMB04_1d1 Expression Region:1-252 Sequence Info:fµLl length protein