Skip to Content

ELISA Recombinant Glycerol-3-phosphate acyltransferase 3(AGPAT9)

https://www.paratuberculosis.info/web/image/product.template/133218/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q53EU6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ KNYSKMIVGNGSLS Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase 3 Short name= GPAT-3 EC= 2.3.1.15 Alternative name(s): 1-acylglycerol-3-phosphate O-acyltransferase 9 Short name= 1-AGP acyltransferase 9 Short name= 1-AGPAT 9 Gene Names:Name:AGPAT9 Synonyms:GPAT3, MAG1 ORF Names:HMFN0839, UNQ2753/PRO6492 Expression Region:1-434 Sequence Info:fµLl length protein

1,793.00 € 1793.0 EUR 1,793.00 €

1,793.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF684468HU