Skip to Content

ELISA Recombinant Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein(HERPUD1)

https://www.paratuberculosis.info/web/image/product.template/133850/image_1920?unique=3f1195a
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q15011 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESETEPEPVTLLVKSPNQRHRDLELSGDRGWSVGHLKAHLSRVYPERPRPEDQRLIYSG KLLLDHQCLRDLLPKQEKRHVLHLVCNVKSPSKMPEINAKVAESTEEPAGSNRGQYPEDS SSDGLRQREVLRNLSSPGWENISRPEAAQQAFQGLGPGFSGYTPYGWLQLSWFQQIYARQ YYMQYLAATAASGAFVPPPSAQEIPVVSAPAPAPIHNQFPAENQPANQNAAPQVVVNPGA NQNLRMNAQGGPIVEEDDEINRDWLDWTYSAATFSVFLSILYFYSSLSRFLMVMGATVVM YLHHVGWFPFRPRPVQNFPNDGPPPDVVNQDPNNNLQEGTDPETEDPNHLPPDRDVLDGE QTSPSFMSTAWLVFKTFFASLLPEGPPAIAN Protein Names:Recommended name: Homocysteine-responsive endoplasmic reticµLum-resident ubiquitin-like domain member 1 protein Alternative name(s): Methyl methanesµLfonate (MMF)-inducible fragment protein 1 Gene Names:Name:HERPUD1 Synonyms:HERP, KIAA0025, MIF1 Expression Region:1-391 Sequence Info:fµLl length protein

1,748.00 € 1748.0 EUR 1,748.00 €

1,748.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF622984HU