ELISA Recombinant Methylsterol monooxygenase 1(MSMO1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q15800 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MATNESVSIFSSASLAVEYVDSLLPENPLQEPFKNAWNYmLNNYTKFQIATWGSLIVHEA LYFLFCLPGFLFQFIPYMKKYKIQKDKPETWENQWKCFKVLLFNHFCIQLPLICGTYYFT EYFNIPYDWERMPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPF GMEAEYAHPLETLILGTGFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNL IPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE Protein Names:Recommended name: Methylsterol monooxygenase 1 EC= 1.14.13.72 Alternative name(s): C-4 methylsterol oxidase Gene Names:Name:MSMO1 Synonyms:DESP4, ERG25, SC4MOL Expression Region:1-293 Sequence Info:fµLl length protein