ELISA Recombinant Mitochondrial inner membrane protein OXA1L(OXA1L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q15070 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAE Protein Names:Recommended name: Mitochondrial inner membrane protein OXA1L Alternative name(s): Hsa OXA1Hs Oxidase assembly 1-like protein Short name= OXA1-like protein Gene Names:Name:OXA1L Expression Region:1-113 Sequence Info:fµLl length protein