ELISA Recombinant Mitochondrial inner membrane protein OXA1L(OXA1L)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Homo sapiens ()
Uniprot NO.:Q15070
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAE
Protein Names:Recommended name: Mitochondrial inner membrane protein OXA1L Alternative name(s): Hsa OXA1Hs Oxidase assembly 1-like protein Short name= OXA1-like protein
Gene Names:Name:OXA1L
Expression Region:1-113
Sequence Info:fµLl length protein
Internal Reference:
CSB-CF613583HU