Skip to Content

ELISA Recombinant Photoreceptor outer segment membrane glycoprotein 2

https://www.paratuberculosis.info/web/image/product.template/121851/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:O42282 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTVLKVKFTKTKRDKLAQILWILNWVSVVSGIILFSLGLFLKIEIKKRNEVMAKGDINSV PNmLISVGVIACVVNFLGGKICYDCSDANKFSRWKLImLPYIICTFCFTFCILLGALMCY TMRNELEESLYLGLRDAIKFYKDTDIPGRCFLKKTVDmLQIGFQCCGNNGFRDWFEVQWV SARYLNMASKEVMDRFKSNVDGKFLVDGVPFSCCNPSSPRPCIQYHLTNNSAHYNYDFLT EELNIWVKGCREALLEYYTAIMRSIGIAALLIWLFELSVLIGVRYLQTAMKNVLLQGDLQ GESDGWLLENSFVETAKYNINIIKNLGKANQISTVSGMNDPNINVQNTNCGKSNVTAKSI PAAS Protein Names:Recommended name: Photoreceptor outer segment membrane glycoprotein 2 Alternative name(s): CRDS2 Gene Names: Expression Region:1-364 Sequence Info:fµLl length protein

1,719.00 € 1719.0 EUR 1,719.00 €

1,719.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF520356CH