ELISA Recombinant Immunoglobulin superfamily member 23(IGSF23)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:A1L1A6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRAKPQSPLPRNPVPAWSPPTTTTDPmLEKDAAGGDFPANLVLQLMPLKTFPAAIRGVIQ SELNYSVILQWVVTMDPEPVLSWTFSGVPCGMGEKLFIRRLSCEQLGTYMCIATNSKKQL VSEPVTISLPKPIMQPTEAEPMEPDPTLSLSGGSAIGLLAAGILGAGALIAGMCFIIIQS LRTDRQRIGICS Protein Names:Recommended name: ImmunoglobµLin superfamily member 23 Gene Names:Name:IGSF23 Expression Region:1-192 Sequence Info:fµLl length protein