ELISA Recombinant HERV-K_11q22.1 provirus ancestral Env polyprotein

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P61570 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FIFTLIAVIMGLIAVTATGAVAGVALHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQ INDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRRHLQGREDN LTLDISKLKEQIFKASKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILIL VCLFCLLLVCRCTQQL Protein Names:Recommended name: HERV-K_11q22.1 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein Cleaved into the following 2 chains: 1. Surface protein Short name= 2. SU 3. Transmembrane protein Short name= 4. T Gene Names: Expression Region:466-661 Sequence Info:fµLl length protein