ELISA Recombinant HERV-K_22q11.21 provirus ancestral Env polyprotein

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P61566 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:FIFTLIAVIMGLIAVTATGAVAGVALHSSVQSVNFVNDWQKNSTRLWNSQSSIDQKLANQ INDLRQTVIWMGDRLMSLEHRFQLQCDWNTSDFCITPQIYNESEHHWDMVRHHLQGREDN LTLDISKLKEQIFEASKAHLNLVPGTEAIAGVADGLANLNPVTWVKTIGSTTIINLILIL VCLFCLLLVCRCTQQLRRDSDHRERAMMTMAVLSKRKGGNVGKSKRDQIVTVSV Protein Names:Recommended name: HERV-K_22q11.21 provirus ancestral Env polyprotein Alternative name(s): Envelope polyprotein HERV-K101 envelope protein Cleaved into the following 2 chains: 1. Surface protein Short name= 2. SU 3. Transmembrane Gene Names: Expression Region:355-588 Sequence Info:fµLl length protein