ELISA Recombinant Phosphoinositide-interacting protein(PIRT)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P0C851 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMS VGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMmLVCGLVWVPIIKKKQKH RQKSNFLRSLKSFFLTR Protein Names:Recommended name: Phosphoinositide-interacting protein Gene Names:Name:PIRT Expression Region:1-137 Sequence Info:fµLl length protein