Skip to Content

ELISA Recombinant Olfactory receptor 4E1(OR4E1)

https://www.paratuberculosis.info/web/image/product.template/129079/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P0C645 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLH TPMYFFLSNLSFIDVCHSTVTVPKmLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLT VMAYDRYVAICKPLQYMIVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDN FFCDVPQVIKLACIDTPYVLEILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWK ALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMK SALNKLVGRKERKEEK Protein Names:Recommended name: Olfactory receptor 4E1 Alternative name(s): Olfactory receptor OR14-43 Gene Names:Name:OR4E1 Synonyms:OR4E1P Expression Region:1-316 Sequence Info:fµLl length protein

1,669.00 € 1669.0 EUR 1,669.00 €

1,669.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF314427HU