Skip to Content

ELISA Recombinant Mitochondrial uncoupling protein 4(SLC25A27)

https://www.paratuberculosis.info/web/image/product.template/135374/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O95847 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSVPEEEERLLPLTQRWPRASKFLLSGCAATVAELATFPLDLTKTRLQMQGEAALARLGD GARESAPYRGMVRTALGIIEEEGFLKLWQGVTPAIYRHVVYSGGRMVTYEHLREVVFGKS EDEHYPLWKSVIGGMMAGVIGQFLANPTDLVKVQMQMEGKRKLEGKPLRFRGVHHAFAKI LAEGGIRGLWAGWVPNIQRAALVNMGDLTTYDTVKHYLVLNTPLEDNIMTHGLSSLCSGL VASILGTPADVIKSRIMNQPRDKQGRGLLYKSSTDCLIQAVQGEGFMSLYKGFLPSWLRM TPWSMVFWLTYEKIREMSGVSPF Protein Names:Recommended name: Mitochondrial uncoupling protein 4 Short name= UCP 4 Alternative name(s): Solute carrier family 25 member 27 Gene Names:Name:SLC25A27 Synonyms:UCP4 ORF Names:UNQ772/PRO1566 Expression Region:1-323 Sequence Info:FµLl length protein

1,676.00 € 1676.0 EUR 1,676.00 €

1,676.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF021496HU