Skip to Content

ELISA Recombinant Mitochondrial 2-oxoglutarate-malate carrier protein(SLC25A11)

https://www.paratuberculosis.info/web/image/product.template/135330/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:Q02978 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AATASAGAGGIDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTREY KTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KAVIGMTAGATGAFVGTPAEVALIRMTADGRLPADQRRGYKNVFNALIRITREEGVLTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPVD IAKTRIQNMRMIDGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG Protein Names:Recommended name: Mitochondrial 2-oxoglutarate/malate carrier protein Short name= OGCP Alternative name(s): Solute carrier family 25 member 11 Gene Names:Name:SLC25A11 Synonyms:SLC20A4 Expression Region:2-314 Sequence Info:FµLl length protein

1,665.00 € 1665.0 EUR 1,665.00 €

1,665.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF021477HU