Skip to Content

ELISA Recombinant Phosphatidylserine synthase 2(PTDSS1)

https://www.paratuberculosis.info/web/image/product.template/122011/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Gallus gallus (Chicken) Uniprot NO.:E1BYA3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRRGERRGPAGPLGDGPALGLRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLL EETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFI LFQTVQDGRQFMKYIDPHLGVPLPERDYGGNCLIYDPGNESDPFHNIWDKLDGFVPAHFF GWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVILCNGLGIYCGM KTLSWLSLKTYKWQGLWNIPTYKGKMKRIVFQFTPYSWVKFEWKPASSLRRWLAVCGIIF VFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKFHKKLGQQA WLVAAITATEFLIVVKYDPYTLTLSLPFYITQCWILGIILVLTWTAWRFFIRDITLRYKE IRRQKQEHKYEKDKCLSNGDGH Protein Names:Recommended name: Phosphatidylserine synthase 2 Short name= PSS-2 Short name= PtdSer synthase 2 EC= 2.7.8.29 Alternative name(s): Serine-exchange enzyme II Gene Names:Name:PTDSS1 Expression Region:1-442 Sequence Info:fµLl length protein

1,802.00 € 1802.0 EUR 1,802.00 €

1,802.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF018963CH