Skip to Content

ELISA Recombinant Lipid phosphate phosphohydrolase 2(PPAP2C)

https://www.paratuberculosis.info/web/image/product.template/134796/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O43688 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS Protein Names:Recommended name: Lipid phosphate phosphohydrolase 2 EC= 3.1.3.4 Alternative name(s): PAP2-gamma Short name= PAP2-G Phosphatidate phosphohydrolase type 2c Phosphatidic acid phosphatase 2c Short name= PAP-2c Short n Gene Names:Name:PPAP2C Synonyms:LPP2 Expression Region:1-288 Sequence Info:FµLl length protein

1,639.00 € 1639.0 EUR 1,639.00 €

1,639.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF018416HU