ELISA Recombinant Olfactory receptor 9G9(OR9G9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P0C7N8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MQRSNHTVTEFILLGFTTDPGMQLGLFVVFLGVYSLTVVGNSTLIVLICNDSHLHTPMYF VVGNLSFLDLWYSSVYTPKILVICISEDKSISFAGCLCQFFFSAGLAYSECCLLAAMAYD RYVAISKPLLYAQAMSIKLCALLVAVSYCGGFINSSIITKKTFSFNFCCENIIDDFFCDL LPLVKLACGEKGCYKFLMYFLLASNVICPAVLILASYLFIITSVLRISSSQGRLKAFSTC SSHLTSVTLYYGSILYIYALPRSSYSFDMDKIVSTFYTEVLPmLNPMIYSLRNKDVKEAL KKLLP Protein Names:Recommended name: Olfactory receptor 9G9 Gene Names:Name:OR9G9 Expression Region:1-305 Sequence Info:FµLl length protein