Skip to Content

ELISA Recombinant Olfactory receptor 8U8(OR8U8)

https://www.paratuberculosis.info/web/image/product.template/136538/image_1920?unique=f2aba11
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P0C7N1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAHINCTQATEFILVGLTDHQELKMPLFVLFLSIYLFTVVGNLGLILLIRADTSLNTPMY FFLSNLAFVDFCYSSVITPKmLGNFLYKQNVISFDACATQLGCFLTFMVSESLLLASMAY DRYVAICNPLLYMVVMTPGICIQLVAVPYSYSFLMALFHTILTFRLSYCHSNIVNHFYCD DMPLLRLTCSDTRFKQLWILACAGITFICSVLIVFVSYMFIIFAILRMSSAEGRRKAFST CSSHmLAVTIFYGTLIFMYLQPSSSHSLDADKMASVFYTVIIPmLNPLIYSLRNKDVKDA LKKVIINRNHAFIFLKLRK Protein Names:Recommended name: Olfactory receptor 8U8 Gene Names:Name:OR8U8 Expression Region:1-319 Sequence Info:FµLl length protein

1,672.00 € 1672.0 EUR 1,672.00 €

1,672.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF017201HU