ELISA Recombinant Olfactory receptor 4D2(OR4D2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P58180 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMY FLLRNLAVLDLCFSSVTAPKmLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAF DRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALmLPLPFCGPNILDNFYCD VPQVLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMSYLFILVmLRSHPGEARRKAASTC TTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTPmLNPMIYTLRNQDMQAAVRR LGRHRLV Protein Names:Recommended name: Olfactory receptor 4D2 Alternative name(s): B-lymphocyte membrane protein BC2009 Olfactory receptor OR17-24 Gene Names:Name:OR4D2 Expression Region:1-307 Sequence Info:FµLl length protein