ELISA Recombinant Olfactory receptor 1F1(OR1F1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O43749 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGTNQSSVSEFLLLGLSRQPQQQHLLFVFFLSMYLATVLGNLLIILSVSIDSCLHTPMY FFLSNLSFVDICFSFTTVPKmLANHILETQTISFCGCLTQMYFVFMFVDMDNFLLAVMAY DHFVAVCHPLHYTAKMTHQLCALLVAGLWVVANLNVLLHTLLMAPLSFCADNAITHFFCD VTPLLKLSCSDTHLNEVIILSEGALVMITPFLCILASYMHITCTVLKVPSTKGRWKAFST CGSHLAVVLLFYSTIIAVYFNPLSSHSAEKDTMATVLYTVVTPmLNPFIYSLRNRYLKGA LKKVVGRVVFSV Protein Names:Recommended name: Olfactory receptor 1F1 Alternative name(s): Olfactory receptor 16-35 Short name= OR16-35 Olfactory receptor 1F10 Olfactory receptor 1F4 Olfactory receptor 1F5 Olfactory receptor 1F6 Olfactory receptor 1 Gene Names:Name:OR1F1 Synonyms:OLFMF, OR1F10, OR1F4, OR1F5, OR1F6, OR1F7, OR1F8, OR1F9 Expression Region:1-312 Sequence Info:FµLl length protein