Skip to Content

ELISA Recombinant Olfactory receptor 1E2(OR1E2)

https://www.paratuberculosis.info/web/image/product.template/136232/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P47887 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMGQNQTSISDFLLLGLPIQPEQQNLCYALFLAMYLTTLLGNLLIIVLIRLDSHLHTPVY LFLSNLSFSDLCFSSVTMPKLLQNMQNQDPSIPYADCLTQMYFFLYFSDLESFLLVAMAY DRYVAICFPMHYTAICFLLHYTAIMSPmLCLSVVALSWVLTTFHAmLHTLLMARLCFCAD NVIPHFFCDMSALLKLACSDTRVNEWVIFIMGGLILVIPFLLILGSYARIVSSILKVPSS KGICKAFSTCGSHLSVVSLFYGTVIGLYLCPSANSSTLKDTVMAMMYTVVTPmLTPFIYS LRNRDMKGALERVICKRKNPFLL Protein Names:Recommended name: Olfactory receptor 1E2 Alternative name(s): Olfactory receptor 17-93/17-135/17-136 Short name= OR17-135 Short name= OR17-136 Short name= OR17-93 Olfactory receptor 1E4 Gene Names:Name:OR1E2 Synonyms:OR1E4 Expression Region:1-323 Sequence Info:FµLl length protein

1,676.00 € 1676.0 EUR 1,676.00 €

1,676.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF016495HU