ELISA Recombinant Neuropeptide Y receptor type 2(NPY2R)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:O02836 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGPIGAEADENQTVEEMKMEPSGPGHTTPRGELAPDSEPELKDSTKLIEVQIILILAYCS IILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMG PVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGISALL ASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSIYGTVYSLSSLLILYVLPLGIISFSY ARIWSKLKNHVSPGGVNDHYHQRRQKTTKmLVCVVVVFAVSWLPLHAFQLAVDIDSQVLD LKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMTSKA KKNLEATKNGGPDDSFTEATNV Protein Names:Recommended name: Neuropeptide Y receptor type 2 Short name= NPY2-R Alternative name(s): NPY-Y2 receptor Short name= Y2 receptor Gene Names:Name:NPY2R Expression Region:1-382 Sequence Info:FµLl length protein