Skip to Content

ELISA Recombinant Myeloid-associated differentiation marker-like protein 2(MYADML2)

https://www.paratuberculosis.info/web/image/product.template/135618/image_1920?unique=706639d
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:A6NDP7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGSTMEPPGGAYLHLGAVTSPVGTARVLQLAFGCTTFSLVAHRGGFAGVQGTFCMAAWGF CFAVSALVVACEFTRLHGCLRLSWGNFTAAFAmLATLLCATAAVLYPLYFARRECSPEPA GCAARDFRLAASVFAGLLFLAYAVEVALTRARPGQVSSYMATVSGLLKIVQAFVACIIFG ALVHDSRYGRYVATQWCVAVYSLCFLATVAVVALSVMGHTGGLGCPFDRLVVVYTFLAVL LYLSAAVIWPVFCFDPKYGEPKRPPNCARGSCPWDSQLVVAIFTYVNLLLYVVDLAYSQR IRFVPSL Protein Names:Recommended name: Myeloid-associated differentiation marker-like protein 2 Gene Names:Name:MYADmL2 Expression Region:1-307 Sequence Info:FµLl length protein

1,659.00 € 1659.0 EUR 1,659.00 €

1,659.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days


Internal Reference: CSB-CF015260HU