ELISA Recombinant Melatonin receptor type 1A(MTNR1A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Sus scrofa (Pig) Uniprot NO.:O02781 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YCYICHSLKYDRWYSNRNSLCCVFLICVLTLVAIVPNLCMGTLQYDPRIYSCTFAQSVSS AYTIAVVVFHFLVPMVIVIFRYLRIWVLVLQIRWRAKPENNPRLKPQDFRNFVTMFVVFV LFAICWAPLNFIGLAVASDPASMAPRIPEWLFVA Protein Names:Recommended name: Melatonin receptor type 1A Short name= Mel-1A-R Short name= Mel1a receptor Gene Names:Name:MTNR1A Expression Region:1-154 Sequence Info:FµLl length protein