ELISA Recombinant Mannose-P-dolichol utilization defect 1 protein(MPDU1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O75352 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQ VFKILGAKSAEGLSLQSVmLELVALTGTMVYSITNNFPFSSWGEALFLmLQTITICFLVM HYRGQTVKGVAFLACYGLVLLVLLSPLTPLTVVTLLQASNVPAVVVGRLLQAATNYHNGH TGQLSAITVFLLFGGSLARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPH KQKKAQ Protein Names:Recommended name: Mannose-P-dolichol utilization defect 1 protein Alternative name(s): Suppressor of Lec15 and Lec35 glycosylation mutation homolog Short name= SL15 Gene Names:Name:MPDU1 Expression Region:2-247 Sequence Info:FµLl length protein