ELISA Recombinant Microsomal glutathione S-transferase 1(MGST1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P10620 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:VDLTQVMDDEVFMAFASYATIILSKMmLMSTATAFYRLTRKVFANPEDCVAFGKGENAKK YLRTDDRVERVRRAHLNDLENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIAY LTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL Protein Names:Recommended name: Microsomal glutathione S-transferase 1 Short name= Microsomal GST-1 EC= 2.5.1.18 Alternative name(s): Microsomal GST-I Gene Names:Name:MGST1 Synonyms:GST12, MGST Expression Region:2-155 Sequence Info:FµLl length protein