ELISA Recombinant Myelin and lymphocyte protein(MAL)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:P21145 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPAAATGGSTLPSGFSVFTTLPDLLFIFEFIFGGLVWILVASSLVPWPLVQGWVMFVSV FCFVATTTLIILYIIGAHGGETSWVTLDAAYHCTAALFYLSASVLEALATITMQDGFTYR HYHENIAAVVFSYIATLLYVVHAVFSLIRWKSS Protein Names:Recommended name: Myelin and lymphocyte protein Alternative name(s): T-lymphocyte maturation-associated protein Gene Names:Name:MAL Expression Region:1-153 Sequence Info:FµLl length protein