ELISA Recombinant Leptin receptor overlapping transcript-like 1(LEPROTL1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Homo sapiens () Uniprot NO.:O95214 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGIKALISLSFGGAIGLMFLmLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTD AMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVF GSNDDFSWQQW Protein Names:Recommended name: Leptin receptor overlapping transcript-like 1 Gene Names:Name:LEPROTL1 ORF Names:My047, UNQ577/PRO1139 Expression Region:1-131 Sequence Info:FµLl length protein